| Brand: | Abnova |
| Reference: | P3507 |
| Product name: | TXN (Human) Recombinant Protein |
| Product description: | Human TXN (NP_003320, 1 a.a. - 105 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 7295 |
| Gene name: | TXN |
| Gene alias: | DKFZp686B1993|MGC61975|TRX|TRX1 |
| Gene description: | thioredoxin |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV |
| Protein accession: | NP_003320 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS, pH 7.4 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |