No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | Func,SDS-PAGE |
Brand: | Abnova |
Reference: | P3484 |
Product name: | FKBP1A (Human) Recombinant Protein |
Product description: | Human FKBP1A (NP_463460, 1 a.a. - 108 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 2280 |
Gene name: | FKBP1A |
Gene alias: | FKBP-12|FKBP1|FKBP12|FKBP12C|PKC12|PKCI2|PPIASE |
Gene description: | FK506 binding protein 1A, 12kDa |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE |
Protein accession: | NP_463460 |
Form: | Liquid |
Concentration: | 1 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, 100 mM NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![]() |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | Func,SDS-PAGE |
Shipping condition: | Dry Ice |