| Brand: | Abnova |
| Reference: | P3473 |
| Product name: | PPIL1 (Human) Recombinant Protein |
| Product description: | Human PPIL1 (NP_057143, 1 a.a. - 166 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 51645 |
| Gene name: | PPIL1 |
| Gene alias: | CGI-124|CYPL1|MGC678|PPIase|hCyPX |
| Gene description: | peptidylprolyl isomerase (cyclophilin)-like 1 |
| Immunogen sequence/protein sequence: | MAAIPPDSWQPPNVYLETSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASIYGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMVETNSQDRPVDDVKIIKAYPSGLEHHHHHH |
| Protein accession: | NP_057143 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (20% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |