Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FGF2 (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | Func,SDS-PAGE |
More info about FGF2 (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3469 |
| Product name: | FGF2 (Human) Recombinant Protein |
| Product description: | Human FGF2 (NP_001997.5, 143 a.a. - 288 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 2247 |
| Gene name: | FGF2 |
| Gene alias: | BFGF|FGFB|HBGF-2 |
| Gene description: | fibroblast growth factor 2 (basic) |
| Immunogen sequence/protein sequence: | MPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Protein accession: | NP_001997.5 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 50 mM Tris, pH 8.0 |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |