| Brand: | Abnova |
| Reference: | P3468 |
| Product name: | PPIH (Human) Recombinant Protein |
| Product description: | Human PPIH (NP_006338, 1 a.a. - 177 a.a.) full-length recombinant protein expressed in Escherichia coli. |
| Gene id: | 10465 |
| Gene name: | PPIH |
| Gene alias: | CYP-20|CYPH|MGC5016|SnuCyp-20|USA-CYP |
| Gene description: | peptidylprolyl isomerase H (cyclophilin H) |
| Immunogen sequence/protein sequence: | MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM |
| Protein accession: | NP_006338 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In PBS, pH 7.4 (10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |