| Brand: | Abnova |
| Reference: | P3444 |
| Product name: | PTPN1 (Human) Recombinant Protein |
| Product description: | Human PTPN1 (NP_002818, 1 a.a. - 321 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Gene id: | 5770 |
| Gene name: | PTPN1 |
| Gene alias: | PTP1B |
| Gene description: | protein tyrosine phosphatase, non-receptor type 1 |
| Immunogen sequence/protein sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHN |
| Protein accession: | NP_002818 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 25 mM Tris-HCl, 1 mM EDTA, pH 7.5 (2 mM beta-mercaptoethanol, 1 mM dithiothreitol, 20% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 12% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | None |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | Func,SDS-PAGE |
| Shipping condition: | Dry Ice |