| Brand: | Abnova |
| Reference: | P3434 |
| Product name: | MAP1LC3B2 (Human) Recombinant Protein |
| Product description: | Human MAP1LC3B2 (NP_001078950, 1 a.a. - 120 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 643246 |
| Gene name: | MAP1LC3B2 |
| Gene alias: | - |
| Gene description: | microtubule-associated protein 1 light chain 3 beta 2 |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG |
| Protein accession: | NP_001078950 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 0.1M NaCl, pH 8.0 (1 mM dithiothreitol, 10% glycerol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |