| Brand: | Abnova |
| Reference: | P3428 |
| Product name: | URM1 (Human) Recombinant Protein |
| Product description: | Human URM1 (NP_112176, 1 a.a. - 101 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 81605 |
| Gene name: | URM1 |
| Gene alias: | C9orf74|MGC2668 |
| Gene description: | ubiquitin related modifier 1 homolog (S. cerevisiae) |
| Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMAAPLSVEVEFGGGAELLFDGIKKHRVTLPGQEEPWDIRNLLIWIKKNLLKERPELFIQGDSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG |
| Protein accession: | NP_112176 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, pH 8.0 (10% glycerol, 1 mM dithiothreitol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |