No products
Prices are tax excluded
Brand | Abnova |
Product type | Proteins |
Host species | Escherichia coli |
Applications | SDS-PAGE |
Brand: | Abnova |
Reference: | P3412 |
Product name: | SBDS (Human) Recombinant Protein |
Product description: | Human SBDS (NP_057122, 1 a.a. - 250 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli. |
Gene id: | 51119 |
Gene name: | SBDS |
Gene alias: | CGI-97|FLJ10917|SDS|SWDS |
Gene description: | Shwachman-Bodian-Diamond syndrome |
Immunogen sequence/protein sequence: | MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |
Protein accession: | NP_057122 |
Form: | Liquid |
Concentration: | 0.5 mg/mL |
Preparation method: | Escherichia coli expression system |
Storage buffer: | In 20 mM Tris-HCl, 50 mM NaCl, 0.1 mM EDTA, pH 8.0 (2 mM dithiothreitol, 20% glycerol) |
Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
Quality control testing picture: | ![]() |
Tag: | His |
Product type: | Proteins |
Host species: | Escherichia coli |
Antigen species / target species: | Human |
Applications: | SDS-PAGE |
Shipping condition: | Dry Ice |