Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CEBPA (Human) Recombinant Protein
| Brand | Abnova |
| Product type | Proteins |
| Host species | Escherichia coli |
| Applications | SDS-PAGE |
More info about CEBPA (Human) Recombinant Protein
| Brand: | Abnova |
| Reference: | P3389 |
| Product name: | CEBPA (Human) Recombinant Protein |
| Product description: | Human CEBPA (NP_004355, 270 a.a. - 358 a.a.) partial recombinant protein with His tag expressed in Escherichia coli. |
| Gene id: | 1050 |
| Gene name: | CEBPA |
| Gene alias: | C/EBP-alpha|CEBP |
| Gene description: | CCAAT/enhancer binding protein (C/EBP), alpha |
| Immunogen sequence/protein sequence: | MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA |
| Protein accession: | NP_004355 |
| Form: | Liquid |
| Concentration: | 1 mg/mL |
| Preparation method: | Escherichia coli expression system |
| Storage buffer: | In 20 mM Tris-HCl, 0.1M NaCl, pH 7.5 (5 mM beta-Mercaptoethanol) |
| Storage instruction: | Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Loading 3 ug protein in 15% SDS-PAGE |
| Quality control testing picture: |  |
| Tag: | His |
| Product type: | Proteins |
| Host species: | Escherichia coli |
| Antigen species / target species: | Human |
| Applications: | SDS-PAGE |
| Shipping condition: | Dry Ice |