Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TGFB2 (Human) Recombinant Protein, Active
| Brand | Abnova |
| Product type | Proteins |
| Origin species | Human |
| Host species | Plants |
| Applications | WB-Re,Func,SDS-PAGE |
More info about TGFB2 (Human) Recombinant Protein, Active
| Reference: | P3378 |
| Product name: | TGFB2 (Human) Recombinant Protein, Active |
| Product description: | Human TGFB2 (two 118 amino acids) recombinent protein with His tag expressed in Nicotiana benthamiana. |
| Gene id: | 7042 |
| Gene name: | TGFB2 |
| Gene alias: | MGC116892|TGF-beta2 |
| Gene description: | transforming growth factor, beta 2 |
| Immunogen sequence/protein sequence: | HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Form: | Lyophilized |
| Preparation method: | Non-transgenic plants (Nicotiana benthamiana) expression system |
| Storage buffer: | Lyophilized from 0.05 M Tris-HCl, pH 7.4. |
| Storage instruction: | Store at -20°C. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 15% SDS-PAGE Stained with Coomassie Blue |
| Note: | Result of activity analysis |
| Tag: | His |
| Shipping condition: | Dry Ice |