No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Chicken,Hamster,Human,Rat |
Host species | Mouse |
Applications | IHC-P |
Brand: | Abnova |
Reference: | MAB7926 |
Product name: | ANO1 monoclonal antibody, clone DOG1.1 |
Product description: | Mouse monoclonal antobody raised against synthetic peptide of ANO1. |
Clone: | DOG1.1 |
Gene id: | 55107 |
Gene name: | ANO1 |
Gene alias: | FLJ10261|ORAOV2|TAOS2|TMEM16A |
Gene description: | anoctamin 1, calcium activated chloride channel |
Immunogen: | A synthetic peptide corresponding to human ANO1. |
Immunogen sequence/protein sequence: | MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER |
Form: | Liquid |
Concentration: | 50 ug/mL |
Recommend dilutions: | Immunohistochemistry (1-2 ug/mL) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.3 (0.09% sodium azide) |
Storage instruction: | Store at 4°C. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Chicken,Hamster,Human,Rat |
Application image: | ![]() |
Application image note: | Immunochemical staining of paraffin human gastrointestinal stroma tumor section stained with ANO1 monoclonal antibody, clone DOG1.1 (Cat # MAB7926), anti-mouse-HRPO polymer kit, and DAB. Please note that both membrane and cytoplasm may be stained. |
Applications: | IHC-P |
Shipping condition: | Blue Ice |