Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ANO1 monoclonal antibody, clone DOG1.1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Chicken,Hamster,Human,Rat |
| Host species | Mouse |
| Applications | IHC-P |
More info about ANO1 monoclonal antibody, clone DOG1.1
| Brand: | Abnova |
| Reference: | MAB7926 |
| Product name: | ANO1 monoclonal antibody, clone DOG1.1 |
| Product description: | Mouse monoclonal antobody raised against synthetic peptide of ANO1. |
| Clone: | DOG1.1 |
| Gene id: | 55107 |
| Gene name: | ANO1 |
| Gene alias: | FLJ10261|ORAOV2|TAOS2|TMEM16A |
| Gene description: | anoctamin 1, calcium activated chloride channel |
| Immunogen: | A synthetic peptide corresponding to human ANO1. |
| Immunogen sequence/protein sequence: | MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKER |
| Form: | Liquid |
| Concentration: | 50 ug/mL |
| Recommend dilutions: | Immunohistochemistry (1-2 ug/mL) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.3 (0.09% sodium azide) |
| Storage instruction: | Store at 4°C. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Chicken,Hamster,Human,Rat |
| Application image: |  |
| Application image note: | Immunochemical staining of paraffin human gastrointestinal stroma tumor section stained with ANO1 monoclonal antibody, clone DOG1.1 (Cat # MAB7926), anti-mouse-HRPO polymer kit, and DAB. Please note that both membrane and cytoplasm may be stained. |
| Applications: | IHC-P |
| Shipping condition: | Blue Ice |