Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNFSF15 monoclonal antibody (M01), clone 1E8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNFSF15 monoclonal antibody (M01), clone 1E8
| Brand: | Abnova |
| Reference: | MAB7163-M01 |
| Product name: | TNFSF15 monoclonal antibody (M01), clone 1E8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFSF15. |
| Clone: | 1E8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 9966 |
| Gene name: | TNFSF15 |
| Gene alias: | MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A |
| Gene description: | tumor necrosis factor (ligand) superfamily, member 15 |
| Genbank accession: | BC074941.2 |
| Immunogen: | TNFSF15 (AAH74941.1, 104 a.a. ~ 251 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Immunogen sequence/protein sequence: | QTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Protein accession: | AAH74941.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |