Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TNFRSF25 monoclonal antibody (M01), clone 1D22
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about TNFRSF25 monoclonal antibody (M01), clone 1D22
| Brand: | Abnova |
| Reference: | MAB5668-M01 |
| Product name: | TNFRSF25 monoclonal antibody (M01), clone 1D22 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF25. |
| Clone: | 1D22 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8718 |
| Gene name: | TNFRSF25 |
| Gene alias: | APO-3|DDR3|DR3|LARD|TNFRSF12|TR3|TRAMP|WSL-1|WSL-LR |
| Gene description: | tumor necrosis factor receptor superfamily, member 25 |
| Genbank accession: | BC117189.1 |
| Immunogen: | TNFRSF25 (AAI17190.1, 24 a.a. ~ 199 a.a) partial recombinant protein with mouse IgG2a-Fc tag. |
| Immunogen sequence/protein sequence: | AQGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ |
| Protein accession: | AAI17190.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |