Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ABCC1 monoclonal antibody, clone IU5C1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ABCC1 monoclonal antibody, clone IU5C1
| Product description: | Mouse monoclonal antibody raised against synthetic peptide of ABCC1. |
| Clone: | IU5C1 |
| Isotype: | IgG1 |
| Gene id: | 4363 |
| Gene name: | ABCC1 |
| Gene alias: | ABC29|ABCC|DKFZp686N04233|DKFZp781G125|GS-X|MRP|MRP1 |
| Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
| Immunogen: | A synthetic peptide corresponding to amino acids 1-33 of human ABCC1. |
| Immunogen sequence/protein sequence: | SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF |
| Protein accession: | P33527 |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (1:250-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In buffer containing 0.09% sodium azide |
| Storage instruction: | Store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Size: | 100 uL |
| Shipping condition: | Dry Ice |