No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr,IP |
Reference: | H00084883-M13 |
Product name: | AMID monoclonal antibody (M13), clone 2C6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AMID. |
Clone: | 2C6 |
Isotype: | IgG1 Kappa |
Gene id: | 84883 |
Gene name: | AIFM2 |
Gene alias: | AMID|PRG3|RP11-367H5.2 |
Gene description: | apoptosis-inducing factor, mitochondrion-associated, 2 |
Genbank accession: | BC006121 |
Immunogen: | AMID (AAH06121, 1 a.a. ~ 339 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG |
Protein accession: | AAH06121 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Shipping condition: | Dry Ice |