View larger

AMID polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of AMID polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00084883-A01
Product name:	AMID polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant AMID.
Gene id:	84883
Gene name:	AIFM2
Gene alias:	AMID\|PRG3\|RP11-367H5.2
Gene description:	apoptosis-inducing factor, mitochondrion-associated, 2
Genbank accession:	NM_032797
Immunogen:	AMID (NP_116186, 188 a.a. ~ 287 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	VRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCA
Protein accession:	NP_116186
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice