No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,IP |
Brand: | Abnova |
Reference: | H00084867-M03 |
Product name: | PTPN5 monoclonal antibody (M03), clone 2H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPN5. |
Clone: | 2H5 |
Isotype: | IgG1 Kappa |
Gene id: | 84867 |
Gene name: | PTPN5 |
Gene alias: | FLJ14427|PTPSTEP|STEP |
Gene description: | protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) |
Genbank accession: | NM_032781 |
Immunogen: | PTPN5 (NP_116170, 388 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEG |
Protein accession: | NP_116170 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PTPN5 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |