Brand: | Abnova |
Reference: | H00084759-D01P |
Product name: | PCGF1 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human PCGF1 protein. |
Gene id: | 84759 |
Gene name: | PCGF1 |
Gene alias: | 2010002K04Rik|FLJ43754|MGC10882|NSPC1|RNF3A-2|RNF68 |
Gene description: | polycomb group ring finger 1 |
Genbank accession: | BC004952.1 |
Immunogen: | PCGF1 (AAH04952.1, 1 a.a. ~ 247 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR |
Protein accession: | AAH04952.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PCGF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |