| Brand: | Abnova |
| Reference: | H00084759-D01P |
| Product name: | PCGF1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PCGF1 protein. |
| Gene id: | 84759 |
| Gene name: | PCGF1 |
| Gene alias: | 2010002K04Rik|FLJ43754|MGC10882|NSPC1|RNF3A-2|RNF68 |
| Gene description: | polycomb group ring finger 1 |
| Genbank accession: | BC004952.1 |
| Immunogen: | PCGF1 (AAH04952.1, 1 a.a. ~ 247 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR |
| Protein accession: | AAH04952.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PCGF1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PCGF1 expression in Jurkat. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |