No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00084750-M04 |
Product name: | FUT10 monoclonal antibody (M04), clone 4H3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant FUT10. |
Clone: | 4H3 |
Isotype: | IgG1 Kappa |
Gene id: | 84750 |
Gene name: | FUT10 |
Gene alias: | MGC11141 |
Gene description: | fucosyltransferase 10 (alpha (1,3) fucosyltransferase) |
Genbank accession: | BC004884 |
Immunogen: | FUT10 (AAH04884, 1 a.a. ~ 92 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEAPTHLNSFLKKEGLTFNRKRKWELDSYPIMLWWSPLTGETGRLGQCGADACFFTINRTYLHHHMTKAFLFYGKQDFRLSPLFAVVFLQS |
Protein accession: | AAH04884 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged FUT10 is approximately 1ng/ml as a capture antibody. |
Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |