Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of COX4I2 monoclonal antibody (M01), clone 1F2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about COX4I2 monoclonal antibody (M01), clone 1F2
| Brand: | Abnova |
| Reference: | H00084701-M01 |
| Product name: | COX4I2 monoclonal antibody (M01), clone 1F2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant COX4I2. |
| Clone: | 1F2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84701 |
| Gene name: | COX4I2 |
| Gene alias: | COX4|COX4-2|COX4B|COX4L2|COXIV-2|dJ857M17.2 |
| Gene description: | cytochrome c oxidase subunit IV isoform 2 (lung) |
| Genbank accession: | NM_032609 |
| Immunogen: | COX4I2 (NP_115998, 21 a.a. ~ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT |
| Protein accession: | NP_115998 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.98 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to COX4I2 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | The cellular stress proteins CHCHD10 and MNRR1 (CHCHD2): Partners in mitochondrial and nuclear function and dysfunction.Purandare N, Somayajulu M, Huttemann M, Grossman LI, Aras S. J Biol Chem. 2018 Apr 27;293(17):6517-6529. doi: 10.1074/jbc.RA117.001073. Epub 2018 Mar 14. |