| Brand: | Abnova |
| Reference: | H00084698-M02 |
| Product name: | CAPS2 monoclonal antibody (M02), clone 3C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CAPS2. |
| Clone: | 3C6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 84698 |
| Gene name: | CAPS2 |
| Gene alias: | FLJ34520|UG0636c06 |
| Gene description: | calcyphosine 2 |
| Genbank accession: | NM_032606 |
| Immunogen: | CAPS2 (NP_115995.1, 285 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YRKSYVRKAFMKLDFNKSGSVPIINIRKCYCAKKHSQVISGHSTEEEIKSSFLETLKVACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVNILRTPWGI |
| Protein accession: | NP_115995.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged CAPS2 is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |