LOXL3 polyclonal antibody (A01) View larger

LOXL3 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOXL3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about LOXL3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00084695-A01
Product name: LOXL3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant LOXL3.
Gene id: 84695
Gene name: LOXL3
Gene alias: LOXL
Gene description: lysyl oxidase-like 3
Genbank accession: NM_032603
Immunogen: LOXL3 (NP_115992, 171 a.a. ~ 270 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: IRPAVGWGRRPLPVTEGLVEVRLPDGWSQVCDKGWSAHNSHVVCGMLGFPSEKRVNAAFYRLLAQRQQHSFGLHGVACVGTEAHLSLCSLEFYRANDTAR
Protein accession: NP_115992
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084695-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: LOX family enzymes expression in vaginal tissue of premenopausal women with severe pelvic organ prolapse.Alarab M, Bortolini MA, Drutz H, Lye S, Shynlova O.
Int Urogynecol J Pelvic Floor Dysfunct. 2010 Jun 18. [Epub ahead of print]

Reviews

Buy LOXL3 polyclonal antibody (A01) now

Add to cart