Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00084680-M02 |
Product name: | PHACS monoclonal antibody (M02), clone 1D2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PHACS. |
Clone: | 1D2 |
Isotype: | IgG3 Kappa |
Gene id: | 84680 |
Gene name: | ACCS |
Gene alias: | ACS|PHACS |
Gene description: | 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional) |
Genbank accession: | NM_032592 |
Immunogen: | PHACS (NP_115981, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MFTLPQKDFRAPTTCLGPTCMQDLGSSHGEDLEGECSRKLDQKLPELRGVGDPAMISSDTSYLSSRGRMIKWFWDSAEEGYRTYHMDEYDEDKNPSGIIN |
Protein accession: | NP_115981 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PHACS expression in transfected 293T cell line by PHACS monoclonal antibody (M02), clone 1D2. Lane 1: PHACS transfected lysate(57.34 KDa). Lane 2: Non-transfected lysate. |
Applications: | IHC-P,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |