| Brand: | Abnova |
| Reference: | H00084665-M04 |
| Product name: | MYPN monoclonal antibody (M04), clone 4C8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MYPN. |
| Clone: | 4C8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 84665 |
| Gene name: | MYPN |
| Gene alias: | MYOP |
| Gene description: | myopalladin |
| Genbank accession: | NM_032578 |
| Immunogen: | MYPN (NP_115967, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQDNPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSS |
| Protein accession: | NP_115967 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MYPN monoclonal antibody (M04), clone 4C8 Western Blot analysis of MYPN expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |