CYorf15B monoclonal antibody (M01), clone 2F5 View larger

CYorf15B monoclonal antibody (M01), clone 2F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CYorf15B monoclonal antibody (M01), clone 2F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CYorf15B monoclonal antibody (M01), clone 2F5

Brand: Abnova
Reference: H00084663-M01
Product name: CYorf15B monoclonal antibody (M01), clone 2F5
Product description: Mouse monoclonal antibody raised against a partial recombinant CYorf15B.
Clone: 2F5
Isotype: IgG1 Kappa
Gene id: 84663
Gene name: CYorf15B
Gene alias: -
Gene description: chromosome Y open reading frame 15B
Genbank accession: NM_032576
Immunogen: CYorf15B (NP_115965, 82 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: YKVFQIKLERLEKLYKALQIERNELSEKLGILKGQVSVKVADVDLAVPVTHSCADLDSSNMLNTSSKRAPGVHLEADPKGMNEVKCYSKALSTGSPLGI
Protein accession: NP_115965
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084663-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084663-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged CYorf15B is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CYorf15B monoclonal antibody (M01), clone 2F5 now

Add to cart