MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P) View larger

MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00084557-D01P
Product name: MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MAP1LC3A protein.
Gene id: 84557
Gene name: MAP1LC3A
Gene alias: LC3|LC3A|MAP1ALC3|MAP1BLC3
Gene description: microtubule-associated protein 1 light chain 3 alpha
Genbank accession: BC015810.1
Immunogen: MAP1LC3A (AAH15810.1 , 1 a.a. ~ 121 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Protein accession: AAH15810.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00084557-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MAP1LC3A expression in transfected 293T cell line (H00084557-T07) by MAP1LC3A MaxPab polyclonal antibody.

Lane 1: MAP1LC3A transfected lysate(13.31 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MAP1LC3A purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart