| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
| Brand: | Abnova |
| Reference: | H00084525-B01P |
| Product name: | HOP purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human HOP protein. |
| Gene id: | 84525 |
| Gene name: | HOPX |
| Gene alias: | Cameo|HOP|LAGY|MGC20820|NECC1|OB1|SMAP31|Toto |
| Gene description: | HOP homeobox |
| Genbank accession: | BC014225 |
| Immunogen: | HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID |
| Protein accession: | AAH14225 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of HOPX expression in transfected 293T cell line (H00084525-T01) by HOPX MaxPab polyclonal antibody. Lane1:HOP transfected lysate(8.14 KDa). Lane 2:Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |