Cart 4 Product Products 1 430,04 € (empty)
No products
To be determined Shipping
1 430,04 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 4 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 430,04 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 430,04 €
Data sheet of HOP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about HOP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00084525-A01 |
| Product name: | HOP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant HOP. |
| Gene id: | 84525 |
| Gene name: | HOPX |
| Gene alias: | Cameo|HOP|LAGY|MGC20820|NECC1|OB1|SMAP31|Toto |
| Gene description: | HOP homeobox |
| Genbank accession: | BC014225 |
| Immunogen: | HOP (AAH14225, 1 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVID |
| Protein accession: | AAH14225 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.14 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |