Brand: | Abnova |
Reference: | H00084517-M01 |
Product name: | ARPM1 monoclonal antibody (M01), clone 2H8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ARPM1. |
Clone: | 2H8 |
Isotype: | IgG2a Kappa |
Gene id: | 84517 |
Gene name: | ARPM1 |
Gene alias: | MGC15664 |
Gene description: | actin related protein M1 |
Genbank accession: | NM_032487 |
Immunogen: | ARPM1 (NP_115876.2, 24 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFE |
Protein accession: | NP_115876.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.85 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ARPM1 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |