ARPM1 monoclonal antibody (M01), clone 2H8 View larger

ARPM1 monoclonal antibody (M01), clone 2H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ARPM1 monoclonal antibody (M01), clone 2H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ARPM1 monoclonal antibody (M01), clone 2H8

Brand: Abnova
Reference: H00084517-M01
Product name: ARPM1 monoclonal antibody (M01), clone 2H8
Product description: Mouse monoclonal antibody raised against a partial recombinant ARPM1.
Clone: 2H8
Isotype: IgG2a Kappa
Gene id: 84517
Gene name: ARPM1
Gene alias: MGC15664
Gene description: actin related protein M1
Genbank accession: NM_032487
Immunogen: ARPM1 (NP_115876.2, 24 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CREPQFIYPNIIGRAKGQSRAAQGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMFFE
Protein accession: NP_115876.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084517-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084517-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ARPM1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ARPM1 monoclonal antibody (M01), clone 2H8 now

Add to cart