| Brand: | Abnova |
| Reference: | H00084446-A01 |
| Product name: | BRSK1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant BRSK1. |
| Gene id: | 84446 |
| Gene name: | BRSK1 |
| Gene alias: | FLJ43009|KIAA1811 |
| Gene description: | BR serine/threonine kinase 1 |
| Genbank accession: | NM_032430 |
| Immunogen: | BRSK1 (NP_115806, 289 a.a. ~ 380 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRK |
| Protein accession: | NP_115806 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.23 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |