No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00084444-M01 |
Product name: | DOT1L monoclonal antibody (M01), clone 6A6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DOT1L. |
Clone: | 6A6 |
Isotype: | IgG1 Kappa |
Gene id: | 84444 |
Gene name: | DOT1L |
Gene alias: | DKFZp586P1823|DOT1|KIAA1814|KMT4 |
Gene description: | DOT1-like, histone H3 methyltransferase (S. cerevisiae) |
Genbank accession: | NM_032482 |
Immunogen: | DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR |
Protein accession: | NP_115871 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged DOT1L is approximately 0.03ng/ml as a capture antibody. |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Incidence of methylated histones H3K4 and H3K79 in cat germinal vesicles is regulated by specific nuclear factors at the acquisition of developmental competence during the folliculogenesis.Phillips TC, Wildt DE, Comizzoli P. J Assist Reprod Genet. 2016 Apr 8. [Epub ahead of print] |