DOT1L polyclonal antibody (A01) View larger

DOT1L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DOT1L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about DOT1L polyclonal antibody (A01)

Brand: Abnova
Reference: H00084444-A01
Product name: DOT1L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DOT1L.
Gene id: 84444
Gene name: DOT1L
Gene alias: DKFZp586P1823|DOT1|KIAA1814|KMT4
Gene description: DOT1-like, histone H3 methyltransferase (S. cerevisiae)
Genbank accession: NM_032482
Immunogen: DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
Protein accession: NP_115871
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084444-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.77 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DOT1L polyclonal antibody (A01) now

Add to cart