| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00084332-M02 |
| Product name: | MGC16186 monoclonal antibody (M02), clone 8G4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MGC16186. |
| Clone: | 8G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84332 |
| Gene name: | DYDC2 |
| Gene alias: | MGC16186|bA36D19.6 |
| Gene description: | DPY30 domain containing 2 |
| Genbank accession: | BC007374 |
| Immunogen: | MGC16186 (AAH07374, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF |
| Protein accession: | AAH07374 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of MGC16186 expression in transfected 293T cell line by MGC16186 monoclonal antibody (M02), clone 8G4. Lane 1: MGC16186 transfected lysate(20.586 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |