MGC16186 MaxPab mouse polyclonal antibody (B01) View larger

MGC16186 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC16186 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about MGC16186 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084332-B01
Product name: MGC16186 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MGC16186 protein.
Gene id: 84332
Gene name: DYDC2
Gene alias: MGC16186|bA36D19.6
Gene description: DPY30 domain containing 2
Genbank accession: NM_032372.3
Immunogen: MGC16186 (NP_115748.1, 1 a.a. ~ 177 a.a) full-length human protein.
Immunogen sequence/protein sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF
Protein accession: NP_115748.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084332-B01-13-15-1.jpg
Application image note: Western Blot analysis of DYDC2 expression in transfected 293T cell line (H00084332-T01) by DYDC2 MaxPab polyclonal antibody.

Lane 1: MGC16186 transfected lysate(19.47 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGC16186 MaxPab mouse polyclonal antibody (B01) now

Add to cart