| Brand: | Abnova |
| Reference: | H00084313-M01 |
| Product name: | MGC10540 monoclonal antibody (M01), clone 2E5-2B9 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant MGC10540. |
| Clone: | 2E5-2B9 |
| Isotype: | IgG1 kappa |
| Gene id: | 84313 |
| Gene name: | VPS25 |
| Gene alias: | DERP9|EAP20|FAP20|MGC10540 |
| Gene description: | vacuolar protein sorting 25 homolog (S. cerevisiae) |
| Genbank accession: | BC006282 |
| Immunogen: | MGC10540 (AAH06282, 1 a.a. ~ 176 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF |
| Protein accession: | AAH06282 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (45.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MGC10540 monoclonal antibody (M01), clone 2E5-2B9 Western Blot analysis of MGC10540 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |