Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MORG1 monoclonal antibody (M02), clone 4E12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MORG1 monoclonal antibody (M02), clone 4E12
| Brand: | Abnova |
| Reference: | H00084292-M02 |
| Product name: | MORG1 monoclonal antibody (M02), clone 4E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MORG1. |
| Clone: | 4E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84292 |
| Gene name: | MORG1 |
| Gene alias: | MGC4238 |
| Gene description: | mitogen-activated protein kinase organizer 1 |
| Genbank accession: | NM_032332 |
| Immunogen: | MORG1 (NP_115708, 171 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFW |
| Protein accession: | NP_115708 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MORG1 is 1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Morg1(+/-) heterozygous mice are protected from experimentally induced focal cerebral ischemia.Stahr A, Frahm C, Kretz A, Bondeva T, Witte OW, Wolf G. Brain Res. 2012 Oct 30;1482:22-31. doi: 10.1016/j.brainres.2012.09.017. Epub 2012 Sep 13. |