No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00084206-M05 |
| Product name: | RKHD3 monoclonal antibody (M05), clone 4C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RKHD3. |
| Clone: | 4C4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 84206 |
| Gene name: | MEX3B |
| Gene alias: | DKFZp434J0617|MEX-3B|MGC117199|RKHD3|RNF195 |
| Gene description: | mex-3 homolog B (C. elegans) |
| Genbank accession: | NM_032246 |
| Immunogen: | RKHD3 (NP_115622, 60 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPG |
| Protein accession: | NP_115622 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |