No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00084172-A01 |
| Product name: | POLR1B polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant POLR1B. |
| Gene id: | 84172 |
| Gene name: | POLR1B |
| Gene alias: | FLJ10816|FLJ21921|MGC131780|RPA135|RPA2|Rpo1-2 |
| Gene description: | polymerase (RNA) I polypeptide B, 128kDa |
| Genbank accession: | NM_019014 |
| Immunogen: | POLR1B (NP_061887, 963 a.a. ~ 1072 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GEMLKAAGYNFYGTERLYSGISGLELEADIFIGVVYYQRLRHMVSDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHDRLFNCSDRSVAHVCVK |
| Protein accession: | NP_061887 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |