No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00084129-A01 |
| Product name: | ACAD11 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ACAD11. |
| Gene id: | 84129 |
| Gene name: | ACAD11 |
| Gene alias: | FLJ12592|MGC150619 |
| Gene description: | acyl-Coenzyme A dehydrogenase family, member 11 |
| Genbank accession: | NM_032169 |
| Immunogen: | ACAD11 (NP_115545, 678 a.a. ~ 780 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | RIAIEKIRLLTLKAAHSMDTLGSAGAKKEIAMIKVAAPRAVSKIVDWAIQVCGGAGVSQDYPLANMYAITRVLRLADGPDEVHLSAIATMELRDQAKRLTAKI |
| Protein accession: | NP_115545 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.44 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | ACAD11 polyclonal antibody (A01), Lot # 060123JC01 Western Blot analysis of ACAD11 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |