No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00084107-M15 |
| Product name: | ZIC4 monoclonal antibody (M15), clone 4F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZIC4. |
| Clone: | 4F3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 84107 |
| Gene name: | ZIC4 |
| Gene alias: | FLJ42609|FLJ45833 |
| Gene description: | Zic family member 4 |
| Genbank accession: | NM_032153 |
| Immunogen: | ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA |
| Protein accession: | NP_115529 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.64 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | ZIC4 monoclonal antibody (M15), clone 4F3. Western Blot analysis of ZIC4 expression in Jurkat. |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |