ZIC4 monoclonal antibody (M13), clone 3H6 View larger

ZIC4 monoclonal antibody (M13), clone 3H6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZIC4 monoclonal antibody (M13), clone 3H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about ZIC4 monoclonal antibody (M13), clone 3H6

Brand: Abnova
Reference: H00084107-M13
Product name: ZIC4 monoclonal antibody (M13), clone 3H6
Product description: Mouse monoclonal antibody raised against a full length recombinant ZIC4.
Clone: 3H6
Isotype: IgG2b Kappa
Gene id: 84107
Gene name: ZIC4
Gene alias: FLJ42609|FLJ45833
Gene description: Zic family member 4
Genbank accession: NM_032153
Immunogen: ZIC4 (NP_115529, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
Protein accession: NP_115529
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00084107-M13-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084107-M13-1-17-1.jpg
Application image note: ZIC4 monoclonal antibody (M13), clone 3H6 Western Blot analysis of ZIC4 expression in C32 ( Cat # L002V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZIC4 monoclonal antibody (M13), clone 3H6 now

Add to cart