Brand: | Abnova |
Reference: | H00084107-M06 |
Product name: | ZIC4 monoclonal antibody (M06), clone 3D5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZIC4. |
Clone: | 3D5 |
Isotype: | IgG2a Kappa |
Gene id: | 84107 |
Gene name: | ZIC4 |
Gene alias: | FLJ42609|FLJ45833 |
Gene description: | Zic family member 4 |
Genbank accession: | NM_032153 |
Immunogen: | ZIC4 (NP_115529, 249 a.a. ~ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV |
Protein accession: | NP_115529 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to ZIC4 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |