PCBD2 purified MaxPab mouse polyclonal antibody (B01P) View larger

PCBD2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCBD2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PCBD2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00084105-B01P
Product name: PCBD2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PCBD2 protein.
Gene id: 84105
Gene name: PCBD2
Gene alias: DCOH2|DCOHM|PHS2
Gene description: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
Genbank accession: NM_032151.3
Immunogen: PCBD2 (NP_115527.2, 1 a.a. ~ 129 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNVQITLTSHDCGELTKKDVKLAKFIEKAAASV
Protein accession: NP_115527.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084105-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PCBD2 expression in transfected 293T cell line (H00084105-T01) by PCBD2 MaxPab polyclonal antibody.

Lane 1: PCBD2 transfected lysate(14.19 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCBD2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart