GAJ MaxPab mouse polyclonal antibody (B01) View larger

GAJ MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GAJ MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about GAJ MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00084057-B01
Product name: GAJ MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human GAJ protein.
Gene id: 84057
Gene name: MND1
Gene alias: GAJ
Gene description: meiotic nuclear divisions 1 homolog (S. cerevisiae)
Genbank accession: BC032142
Immunogen: GAJ (AAH32142, 1 a.a. ~ 205 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSKKKGLSAEEKRTRMMEIFSETKDVFQLKDLEKIAPKEKGITAMSVKEVLQSLVDDGMVDCERIGTSNYYWAFPSKALHARKHKLEVLESQLSEGSQKHASLQKSIEKAKIGRCETEERTRLAKELSSLRDQREQLKAEVEKYKDCDPQVVEEIRQANKVAKEAANRWTDNIFAIKSWAKRKFGFEENKIDRTFGIPEDFDYID
Protein accession: AAH32142
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00084057-B01-2-B4-1.jpg
Application image note: GAJ MaxPab polyclonal antibody. Western Blot analysis of GAJ expression in human skeletal muscle.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GAJ MaxPab mouse polyclonal antibody (B01) now

Add to cart