| Brand: | Abnova |
| Reference: | H00084033-A02 |
| Product name: | OBSCN polyclonal antibody (A02) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant OBSCN. |
| Gene id: | 84033 |
| Gene name: | OBSCN |
| Gene alias: | DKFZp666E245|FLJ14124|KIAA1556|KIAA1639|MGC120409|MGC120410|MGC120411|MGC120412|MGC138590|UNC89 |
| Gene description: | obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF |
| Genbank accession: | XM_290923 |
| Immunogen: | OBSCN (XP_290923, 1551 a.a. ~ 1649 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KAGMGPYSSPSEQVLLGGPSHLASEEESQGRSAQPLPSTKTFAFQTQIQRGRFSVVRQCWEKASGRALAAKIIPYHPKDKTAVLREYEALKGLRHPHLA |
| Protein accession: | XP_290923 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The kinase domains of obscurin interact with intercellular adhesion proteins.Hu LY, Kontrogianni-Konstantopoulos A FASEB J. 2013 Feb 7. |