Cart 27 Product Products 10 278,29 € (empty)
-
1 x Mouse...300,00 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
10 278,29 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 27 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 10 278,29 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 10 278,29 €
Data sheet of KREMEN1 monoclonal antibody (M01), clone 1E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about KREMEN1 monoclonal antibody (M01), clone 1E7
| Brand: | Abnova |
| Reference: | H00083999-M01 |
| Product name: | KREMEN1 monoclonal antibody (M01), clone 1E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KREMEN1. |
| Clone: | 1E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83999 |
| Gene name: | KREMEN1 |
| Gene alias: | FLJ31863|KREMEM1|KREMEN|KRM1 |
| Gene description: | kringle containing transmembrane protein 1 |
| Genbank accession: | NM_032045 |
| Immunogen: | KREMEN1 (NP_114434, 310 a.a. ~ 391 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE |
| Protein accession: | NP_114434 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KREMEN1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |