| Brand: | Abnova |
| Reference: | H00083999-A01 |
| Product name: | KREMEN1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant KREMEN1. |
| Gene id: | 83999 |
| Gene name: | KREMEN1 |
| Gene alias: | FLJ31863|KREMEM1|KREMEN|KRM1 |
| Gene description: | kringle containing transmembrane protein 1 |
| Genbank accession: | NM_032045 |
| Immunogen: | KREMEN1 (NP_114434, 310 a.a. ~ 391 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE |
| Protein accession: | NP_114434 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KREMEN1 polyclonal antibody (A01), Lot # 050914JC01 Western Blot analysis of KREMEN1 expression in Y-79 ( Cat # L042V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |