Cart 5 Product Products 1 883,67 € (empty)
No products
To be determined Shipping
1 883,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 5 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 1 883,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 1 883,67 €
Data sheet of TSSK6 monoclonal antibody (M02A), clone 6F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about TSSK6 monoclonal antibody (M02A), clone 6F5
| Brand: | Abnova |
| Reference: | H00083983-M02A |
| Product name: | TSSK6 monoclonal antibody (M02A), clone 6F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK6. |
| Clone: | 6F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83983 |
| Gene name: | TSSK6 |
| Gene alias: | FLJ24002|SSTK|TSSK4 |
| Gene description: | testis-specific serine kinase 6 |
| Genbank accession: | BC014611 |
| Immunogen: | TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG |
| Protein accession: | AAH14611 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TSSK6 monoclonal antibody (M02A), clone 6F5 Western Blot analysis of TSSK6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |