No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA |
Brand: | Abnova |
Reference: | H00083983-M02A |
Product name: | TSSK6 monoclonal antibody (M02A), clone 6F5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK6. |
Clone: | 6F5 |
Isotype: | IgG2a Kappa |
Gene id: | 83983 |
Gene name: | TSSK6 |
Gene alias: | FLJ24002|SSTK|TSSK4 |
Gene description: | testis-specific serine kinase 6 |
Genbank accession: | BC014611 |
Immunogen: | TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG |
Protein accession: | AAH14611 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | TSSK6 monoclonal antibody (M02A), clone 6F5 Western Blot analysis of TSSK6 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |