| Brand: | Abnova |
| Reference: | H00083983-M02 |
| Product name: | TSSK6 monoclonal antibody (M02), clone 6F5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TSSK6. |
| Clone: | 6F5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 83983 |
| Gene name: | TSSK6 |
| Gene alias: | FLJ24002|SSTK|TSSK4 |
| Gene description: | testis-specific serine kinase 6 |
| Genbank accession: | BC014611 |
| Immunogen: | TSSK6 (AAH14611, 174 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SAAYASPEVLLGIPYDPKKYDVWSMGVVLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQFSPSARPSAGQVARNCWLRAGDSG |
| Protein accession: | AAH14611 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TSSK6 monoclonal antibody (M02), clone 6F5 Western Blot analysis of TSSK6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Expression and Localization of Five Members of the Testis-Specific Serine Kinase (Tssk) Family in Mouse and Human Sperm and Testis.Li Y, Sosnik J, Brassard L, Reese M, Spiridonov NA, Bates TC, Johnson GR, Anguita J, Visconti PE, Salicioni AM. Mol Hum Reprod. 2011 Jan;17(1):42-56. Epub 2010 Aug 20. |